PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G071700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 1299aa    MW: 145416 Da    PI: 8.4326
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G071700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.51.3e-07718759346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +WT eE +++ + ++ +G++ +++Ia+ +  ++t  +c+++++k
  Glyma.13G071700.1.p 718 PWTSEERKIFSEKFEAFGKD-FRKIASFLD-HKTIADCVEFYYK 759
                          8*****************99.*********.***********97 PP

2Myb_DNA-binding32.12.6e-10883923345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           WT eE   +++av  +G + ++ Ia+++g +++  qck ++ 
  Glyma.13G071700.1.p 883 EWTDEEKATFLQAVSSFGED-FRMIAQHVG-TKSKDQCKRFFI 923
                          7*****************99.*********.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-12704762IPR009057Homeodomain-like
PROSITE profilePS5129312.753714765IPR017884SANT domain
SMARTSM007174.0E-6715763IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-4718767IPR009057Homeodomain-like
PROSITE profilePS5129316.226879930IPR017884SANT domain
SMARTSM007174.4E-8880928IPR001005SANT/Myb domain
PfamPF002494.4E-9883923IPR001005SANT/Myb domain
CDDcd001671.16E-7883924No hitNo description
SuperFamilySSF466892.02E-10883930IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-7883922IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1299 aa     Download sequence    Send to blast
MPPKSMLLYQ KGVSKDKEQR RFGSLVRQQH SSCHCGFLEF KNQESTQFQC VGPRIPSGGG  60
GGGARYRFPK EPSQGFCSDY GITLQSRRDP RCKFWEIANN ASLHLSSKRS IGNVLCTSSH  120
APSVNNGEKP YSREQCHHNN NNNNNNNNNN NNNNKNYERE SSSMKRRIDD LLSTPSHACS  180
MNTREKLNFR EQCHDNNKKN YERKGSLGWK PLNKGNNTSE RFYSRSTVNG RDRNMNIVES  240
SANSVTEETR KRPRLSWGEG LAKFEKKKTE GDGVSAATTA TPASCACNSF SASVDNTLCM  300
KAETVDNDVC DLEGSPDTVS PKNHQLKFPL SSQRTDANSW NRLSSSIAEL LHSDKSSSVD  360
SSPEGFTTMT RLQIWKNVIS QVLEQTETEI CSLENELKPL QSEFGDGMPC HNAKTCDIEF  420
GGYDKVTRRP EPSQIDPSHD DNNIEKMMPL STNLHGMHDT TKENDINNPA TSTLKFLEAE  480
PLIKMVSSLS GGSPFSSLMA IEDGMRAQTS AGFYSSINDD TLPNTIISSN RETAQSACAV  540
FEKFLPNETS KTISNVGVSS SSLSHVDEFI KDKFAEKKRF AGFKEKDLTI KHKTFDHLWK  600
KDMCLRYLRK CTRTSPNNLK LHLKVATSCC QKNLSSTHYR CFPFQPAGSK ISLVPTSEMI  660
NCTSQLLSKP QDEVNRKILK LPTLILDQKD KMFSMFHSNN GLVEDPWVVE REKAMINPWT  720
SEERKIFSEK FEAFGKDFRK IASFLDHKTI ADCVEFYYKD HKPNCLEKDK KKKKKNMKKK  780
KGCKSQKSKT VKTVVKVLGK KGNHKANVDS QKKSMMVCGT VANQRTRSGR LLLWRKSDES  840
ERLAADALVG MCDSLSLEAT RPPCQQPVIP NITHQDIDDG TCEWTDEEKA TFLQAVSSFG  900
EDFRMIAQHV GTKSKDQCKR FFIKGQKSHR LDLMRHRLEN IRSLLNEINL GRSANTNDAR  960
VVEAIGNDKL DTETNDHQPS SAANLSHDKS KHMEAWNQLI DLNESKEINK EFDHEDKNIV  1020
SSTYNGESKL VDTDGYGVVL YNSNKSSSVK DKRAKTMPDI MEVGKDKGGD AVTELVSSAS  1080
EIIEPCHSHS VAEDRLVSVM LTSFPTRLDD KDGKHGADMD DDVVELKSQS HDSNTKANTC  1140
LSSVVVSYSA LTFGAENQSK LFLKRSNYSG LSIEDPLPTA NSMLQNTVRA AHAVQQEKSG  1200
TRDGLSFKEP VKKQVNVDMS CVGIVTEPTL LSQKFPQIDD HHNTQLPCLS GSEKTPANHI  1260
VLKLFGKTMT IPSSTQRPDS SEDSKHFIGE KEKKKEEK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1770780KKKKKNMKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621020.10.0PREDICTED: nuclear receptor corepressor 1-like
TrEMBLA0A0R0GJK90.0A0A0R0GJK9_SOYBN; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-48MYB family protein